PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_107.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 732aa    MW: 80812.3 Da    PI: 5.566
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_107.25genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.4e-2154109156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   ++k +++t++q++eLe +F+++++p++++r eL+k+lgL+ +q+k+WFqNrR+++k
  evm.model.supercontig_107.25  54 KKKYHRHTPHQIQELEFFFKECPHPDEKQRSELSKRLGLENKQIKFWFQNRRTQMK 109
                                   79999************************************************999 PP

2START187.76.2e-592554782206
                                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT- CS
                         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWd 73 
                                   la++a++el+k++  ++p+W ks     + +n +e++++f++  +     + +ea+r+sg+v+ ++  lve l+d + +W 
  evm.model.supercontig_107.25 255 LALAAMDELIKMVHTDSPLWIKSLdgrrDLLNHEEYMRTFSPCIGmkpngFVSEASRESGLVIINSLALVEMLMDAN-RWM 334
                                   6899***********************99************999899******************************.*** PP

                                   TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSE CS
                         START  74 etla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvv 143
                                   e+++    +a t++vissg      galq+m++e+q+lsplvp R + f+R+++q+ +g+w++vdvS+d +q+ p+ +  +
  evm.model.supercontig_107.25 335 EMFPciivRAVTVDVISSGtggtrsGALQVMQSEFQVLSPLVPtRQVRFLRFCKQHAEGVWAVVDVSIDITQDGPNAQLHA 415
                                   ***************************************************************************988889 PP

                                   E-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 144 RaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                    +++lpSg+++++++ng skvtwveh +++++ +h l+r lv+ g  +ga +w atlqrqce+
  evm.model.supercontig_107.25 416 SCRRLPSGCIVQDMANGCSKVTWVEHSEYDESAVHPLYRTLVSAGSGFGAHRWIATLQRQCEC 478
                                   999**********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-213893IPR009057Homeodomain-like
SuperFamilySSF466896.27E-2041111IPR009057Homeodomain-like
PROSITE profilePS5007117.39451111IPR001356Homeobox domain
SMARTSM003892.3E-1753115IPR001356Homeobox domain
PfamPF000461.3E-1854109IPR001356Homeobox domain
CDDcd000862.36E-1954111No hitNo description
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.609.2E-494138IPR009057Homeodomain-like
PROSITE profilePS5084843.471245481IPR002913START domain
SuperFamilySSF559617.28E-32248478No hitNo description
CDDcd088751.96E-121249477No hitNo description
SMARTSM002344.3E-45254478IPR002913START domain
PfamPF018525.7E-51255478IPR002913START domain
SuperFamilySSF559611.51E-18521723No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MDDHDELGLL GENFDPGLIG RMREDGYESR SGSDNFEGAS GDDQDAGEDE PPRKKKYHRH  60
TPHQIQELEF FFKECPHPDE KQRSELSKRL GLENKQIKFW FQNRRTQMKT QLERHENVIL  120
RQENDKLRTE NELLKEAMRN PMCNNCGGPG MAGEISYEQH QLRIENARLK DELGRVCALA  180
NKFFGGPMSS LASPVPPSCL NSNLELAVGR NDFGGMSTTG TTLPMVLEFG DGALMPLMKP  240
MGNEMVYERS MFVDLALAAM DELIKMVHTD SPLWIKSLDG RRDLLNHEEY MRTFSPCIGM  300
KPNGFVSEAS RESGLVIINS LALVEMLMDA NRWMEMFPCI IVRAVTVDVI SSGTGGTRSG  360
ALQVMQSEFQ VLSPLVPTRQ VRFLRFCKQH AEGVWAVVDV SIDITQDGPN AQLHASCRRL  420
PSGCIVQDMA NGCSKVTWVE HSEYDESAVH PLYRTLVSAG SGFGAHRWIA TLQRQCECLA  480
ILMSSTLSTE DHSGFSAAGK KSMLKLAQRM TYNFCTGVCA SSVRKWDKLQ IGNVSEDVKV  540
MTRKNINEAG EPPGVVLSAA TSVWMPVTQE RLFNFLRDER LRSEWDILSN GGPMQEMLRI  600
AKGEERGNCV SLMRASANDG NENSMLILQE TWSDASGAVV VYAPVDISCI SVVMGGGDST  660
YVALLPSGFG IVPLPPNKCK GAEGCILTVG FQILVNSLPT AKLTVESVET VNNLISCTIQ  720
KIKASVSLTS P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038621.10.0Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein isoform 1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A061G1P90.0A0A061G1P9_THECC; Homeobox-leucine zipper family protein / lipid-binding START domain-containing protein isoform 1
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein